Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 1680343..1680650 | Replicon | chromosome |
| Accession | NZ_LT992472 | ||
| Organism | Staphylococcus aureus isolate 10_5235 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE26_RS08740 | Protein ID | WP_011447039.1 |
| Coordinates | 1680343..1680519 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1680511..1680650 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE26_RS08720 | 1675578..1679363 | + | 3786 | WP_001644870.1 | phage minor structural protein | - |
| DXE26_RS08725 | 1679353..1679505 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE26_RS08730 | 1679552..1679839 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE26_RS08735 | 1679897..1680193 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE26_RS08740 | 1680343..1680519 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| - | 1680511..1680650 | - | 140 | NuclAT_0 | - | Antitoxin |
| - | 1680511..1680650 | - | 140 | NuclAT_0 | - | Antitoxin |
| - | 1680511..1680650 | - | 140 | NuclAT_0 | - | Antitoxin |
| - | 1680511..1680650 | - | 140 | NuclAT_0 | - | Antitoxin |
| DXE26_RS08745 | 1680572..1680679 | - | 108 | WP_001791821.1 | hypothetical protein | - |
| DXE26_RS08750 | 1680731..1680985 | + | 255 | WP_000611512.1 | phage holin | - |
| DXE26_RS08755 | 1680997..1681752 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE26_RS08760 | 1681943..1682434 | + | 492 | WP_000919350.1 | staphylokinase | - |
| DXE26_RS08770 | 1683084..1683419 | + | 336 | Protein_1604 | SH3 domain-containing protein | - |
| DXE26_RS08775 | 1683514..1683963 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE26_RS08780 | 1684648..1684998 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE26_RS08785 | 1685051..1685311 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / chp / scn | 1638891..1690464 | 51573 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294261 WP_011447039.1 NZ_LT992472:1680343-1680519 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294261 NZ_LT992472:c1680650-1680511 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|