Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2626675..2626859 | Replicon | chromosome |
| Accession | NZ_LT992471 | ||
| Organism | Staphylococcus aureus isolate 17_LA_343 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | DXE46_RS13760 | Protein ID | WP_000482647.1 |
| Coordinates | 2626752..2626859 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2626675..2626735 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE46_RS13735 | 2622129..2622296 | - | 168 | WP_001798790.1 | hypothetical protein | - |
| DXE46_RS13745 | 2622527..2624260 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
| DXE46_RS13750 | 2624285..2626048 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2626675..2626735 | + | 61 | - | - | Antitoxin |
| DXE46_RS13760 | 2626752..2626859 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| DXE46_RS13765 | 2626993..2627379 | - | 387 | WP_000779355.1 | flippase GtxA | - |
| DXE46_RS13770 | 2627646..2628788 | + | 1143 | WP_001176859.1 | glycerate kinase | - |
| DXE46_RS13775 | 2628848..2629507 | + | 660 | WP_000831300.1 | hypothetical protein | - |
| DXE46_RS13780 | 2629695..2630906 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
| DXE46_RS13785 | 2631029..2631502 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T294252 WP_000482647.1 NZ_LT992471:c2626859-2626752 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT294252 NZ_LT992471:2626675-2626735 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|