Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2330809..2331088 | Replicon | chromosome |
Accession | NZ_LT992471 | ||
Organism | Staphylococcus aureus isolate 17_LA_343 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DXE46_RS12145 | Protein ID | WP_001802298.1 |
Coordinates | 2330984..2331088 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2330809..2330988 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE46_RS12125 | 2327010..2327675 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
DXE46_RS12130 | 2327827..2328147 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DXE46_RS12135 | 2328149..2329129 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
DXE46_RS12140 | 2329395..2330486 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2330809..2330988 | + | 180 | - | - | Antitoxin |
DXE46_RS12145 | 2330984..2331088 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
DXE46_RS12160 | 2331768..2331926 | + | 159 | WP_001792784.1 | hypothetical protein | - |
DXE46_RS12165 | 2332362..2332454 | + | 93 | WP_000220902.1 | hypothetical protein | - |
DXE46_RS12170 | 2332584..2333441 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
DXE46_RS12175 | 2333509..2334291 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
DXE46_RS12180 | 2334581..2335189 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294248 WP_001802298.1 NZ_LT992471:c2331088-2330984 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT294248 NZ_LT992471:2330809-2330988 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|