Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2158339..2158638 | Replicon | chromosome |
Accession | NZ_LT992471 | ||
Organism | Staphylococcus aureus isolate 17_LA_343 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DXE46_RS11155 | Protein ID | WP_011447039.1 |
Coordinates | 2158462..2158638 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2158339..2158394 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE46_RS11110 | 2154166..2154413 | + | 248 | Protein_2058 | sphingomyelin phosphodiesterase | - |
DXE46_RS11115 | 2154735..2154914 | + | 180 | WP_000669789.1 | hypothetical protein | - |
DXE46_RS11125 | 2155225..2155485 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DXE46_RS11130 | 2155538..2155888 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DXE46_RS11135 | 2156547..2157038 | - | 492 | WP_000919350.1 | staphylokinase | - |
DXE46_RS11140 | 2157229..2157984 | - | 756 | WP_064131634.1 | CHAP domain-containing protein | - |
DXE46_RS11145 | 2157996..2158250 | - | 255 | WP_000611512.1 | phage holin | - |
DXE46_RS11150 | 2158302..2158409 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2158331..2158470 | + | 140 | NuclAT_0 | - | - |
- | 2158331..2158470 | + | 140 | NuclAT_0 | - | - |
- | 2158331..2158470 | + | 140 | NuclAT_0 | - | - |
- | 2158331..2158470 | + | 140 | NuclAT_0 | - | - |
- | 2158339..2158394 | + | 56 | - | - | Antitoxin |
DXE46_RS11155 | 2158462..2158638 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
DXE46_RS11160 | 2158788..2159084 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DXE46_RS11165 | 2159142..2159429 | - | 288 | WP_001040261.1 | hypothetical protein | - |
DXE46_RS11170 | 2159476..2159628 | - | 153 | WP_001153681.1 | hypothetical protein | - |
DXE46_RS11175 | 2159618..2163402 | - | 3785 | Protein_2070 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2155538..2205448 | 49910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294244 WP_011447039.1 NZ_LT992471:c2158638-2158462 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT294244 NZ_LT992471:2158339-2158394 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|