294240

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 950774..951188 Replicon chromosome
Accession NZ_LT992471
Organism Staphylococcus aureus isolate 17_LA_343

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag DXE46_RS04905 Protein ID WP_031267622.1
Coordinates 950774..951025 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DXE46_RS15265 Protein ID WP_000028424.1
Coordinates 951015..951188 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE46_RS04845 946103..947344 + 1242 WP_001106166.1 AAA family ATPase -
DXE46_RS04850 947341..947556 + 216 WP_021285875.1 hypothetical protein -
DXE46_RS04855 947559..947780 + 222 WP_001123688.1 DUF3269 family protein -
DXE46_RS04860 947790..948197 + 408 WP_021285874.1 RusA family crossover junction endodeoxyribonuclease -
DXE46_RS04865 948197..948382 + 186 WP_021285873.1 DUF3113 family protein -
DXE46_RS04870 948383..949000 + 618 WP_021285872.1 hypothetical protein -
DXE46_RS04875 949000..949254 + 255 WP_021285871.1 DUF3310 domain-containing protein -
DXE46_RS04880 949254..949502 + 249 WP_078069534.1 hypothetical protein -
DXE46_RS04885 949517..949723 + 207 WP_021285869.1 hypothetical protein -
DXE46_RS04890 949726..950133 + 408 WP_000695770.1 hypothetical protein -
DXE46_RS04895 950130..950477 + 348 WP_000979209.1 hypothetical protein -
DXE46_RS04900 950474..950781 + 308 Protein_911 hypothetical protein -
DXE46_RS04905 950774..951025 + 252 WP_031267622.1 DUF1024 family protein Toxin
DXE46_RS15265 951015..951188 + 174 WP_000028424.1 hypothetical protein Antitoxin
DXE46_RS15270 951189..951350 + 162 WP_000889684.1 hypothetical protein -
DXE46_RS04910 951365..951870 + 506 Protein_915 dUTPase -
DXE46_RS04915 951907..952113 + 207 WP_021285914.1 DUF1381 domain-containing protein -
DXE46_RS04920 952110..952313 + 204 WP_000141180.1 hypothetical protein -
DXE46_RS04925 952306..952542 + 237 WP_000608281.1 hypothetical protein -
DXE46_RS04930 952532..952921 + 390 WP_169538641.1 hypothetical protein -
DXE46_RS04935 952918..953091 + 174 WP_000595258.1 transcriptional activator RinB -
DXE46_RS04940 953092..953493 + 402 WP_000286968.1 hypothetical protein -
DXE46_RS04945 953841..954221 + 381 WP_031838201.1 DNA-binding protein -
DXE46_RS04950 954205..955470 + 1266 WP_031838202.1 PBSX family phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp 937688..997609 59921


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9419.35 Da        Isoelectric Point: 3.9476

>T294240 WP_031267622.1 NZ_LT992471:950774-951025 [Staphylococcus aureus]
MNNREKIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT294240 WP_000028424.1 NZ_LT992471:951015-951188 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References