Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 2599017..2599324 | Replicon | chromosome |
| Accession | NZ_LT992470 | ||
| Organism | Staphylococcus aureus isolate 13_LA_301 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE64_RS13340 | Protein ID | WP_011447039.1 |
| Coordinates | 2599017..2599193 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 2599185..2599324 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE64_RS13320 | 2594252..2598037 | + | 3786 | WP_000582165.1 | hypothetical protein | - |
| DXE64_RS13325 | 2598027..2598179 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE64_RS13330 | 2598226..2598513 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE64_RS13335 | 2598571..2598867 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE64_RS13340 | 2599017..2599193 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| - | 2599185..2599324 | - | 140 | NuclAT_0 | - | Antitoxin |
| - | 2599185..2599324 | - | 140 | NuclAT_0 | - | Antitoxin |
| - | 2599185..2599324 | - | 140 | NuclAT_0 | - | Antitoxin |
| - | 2599185..2599324 | - | 140 | NuclAT_0 | - | Antitoxin |
| DXE64_RS13345 | 2599246..2599353 | - | 108 | WP_001791821.1 | hypothetical protein | - |
| DXE64_RS13350 | 2599405..2599659 | + | 255 | WP_000611512.1 | phage holin | - |
| DXE64_RS13355 | 2599671..2600426 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE64_RS13360 | 2600617..2601108 | + | 492 | WP_000919350.1 | staphylokinase | - |
| DXE64_RS13370 | 2601758..2602093 | + | 336 | Protein_2482 | SH3 domain-containing protein | - |
| DXE64_RS13375 | 2602188..2602637 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE64_RS13380 | 2603322..2603672 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE64_RS13385 | 2603725..2603985 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sak / chp / scn | 2552050..2603672 | 51622 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294235 WP_011447039.1 NZ_LT992470:2599017-2599193 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294235 NZ_LT992470:c2599324-2599185 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|