Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 247635..247942 | Replicon | chromosome |
Accession | NZ_LT992469 | ||
Organism | Staphylococcus aureus isolate 15_LA_305 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DXE36_RS01415 | Protein ID | WP_011447039.1 |
Coordinates | 247635..247811 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 247803..247942 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE36_RS01395 | 242870..246655 | + | 3786 | WP_001644870.1 | phage minor structural protein | - |
DXE36_RS01400 | 246645..246797 | + | 153 | WP_001153681.1 | hypothetical protein | - |
DXE36_RS01405 | 246844..247131 | + | 288 | WP_001040261.1 | hypothetical protein | - |
DXE36_RS01410 | 247189..247485 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DXE36_RS01415 | 247635..247811 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
- | 247803..247942 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 247803..247942 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 247803..247942 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 247803..247942 | - | 140 | NuclAT_0 | - | Antitoxin |
DXE36_RS01420 | 247864..247971 | - | 108 | WP_001791821.1 | hypothetical protein | - |
DXE36_RS01425 | 248023..248277 | + | 255 | WP_000611512.1 | phage holin | - |
DXE36_RS01430 | 248289..249044 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DXE36_RS01435 | 249235..249726 | + | 492 | WP_114665717.1 | staphylokinase | - |
DXE36_RS01440 | 250385..250735 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DXE36_RS01445 | 250788..251048 | - | 261 | WP_001791826.1 | hypothetical protein | - |
DXE36_RS01455 | 251359..251538 | - | 180 | WP_000669789.1 | hypothetical protein | - |
DXE36_RS01460 | 251860..252107 | - | 248 | Protein_265 | sphingomyelin phosphodiesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / hlb / sak / scn | 200859..250735 | 49876 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294212 WP_011447039.1 NZ_LT992469:247635-247811 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294212 NZ_LT992469:c247942-247803 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|