Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 75195..75474 | Replicon | chromosome |
Accession | NZ_LT992469 | ||
Organism | Staphylococcus aureus isolate 15_LA_305 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DXE36_RS00400 | Protein ID | WP_001802298.1 |
Coordinates | 75195..75299 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 75295..75474 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE36_RS00365 | 71094..71702 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
DXE36_RS00370 | 71992..72774 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
DXE36_RS00375 | 72842..73699 | + | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
DXE36_RS00380 | 73829..73921 | - | 93 | WP_000220902.1 | hypothetical protein | - |
DXE36_RS00385 | 74357..74515 | - | 159 | WP_001792784.1 | hypothetical protein | - |
DXE36_RS00400 | 75195..75299 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 75295..75474 | - | 180 | - | - | Antitoxin |
DXE36_RS00405 | 75797..76888 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
DXE36_RS00410 | 77154..78134 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
DXE36_RS00415 | 78136..78456 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DXE36_RS00420 | 78608..79273 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294206 WP_001802298.1 NZ_LT992469:75195-75299 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT294206 NZ_LT992469:c75474-75295 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|