Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 14461..14768 | Replicon | chromosome |
Accession | NZ_LT992469 | ||
Organism | Staphylococcus aureus isolate 15_LA_305 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DXE36_RS00080 | Protein ID | WP_011447039.1 |
Coordinates | 14461..14637 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 14629..14768 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE36_RS00060 | 9696..13481 | + | 3786 | WP_075111493.1 | hypothetical protein | - |
DXE36_RS00065 | 13471..13623 | + | 153 | WP_001153681.1 | hypothetical protein | - |
DXE36_RS00070 | 13670..13957 | + | 288 | WP_001040254.1 | hypothetical protein | - |
DXE36_RS00075 | 14015..14311 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DXE36_RS00080 | 14461..14637 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
- | 14629..14768 | - | 140 | NuclAT_1 | - | Antitoxin |
- | 14629..14768 | - | 140 | NuclAT_1 | - | Antitoxin |
- | 14629..14768 | - | 140 | NuclAT_1 | - | Antitoxin |
- | 14629..14768 | - | 140 | NuclAT_1 | - | Antitoxin |
DXE36_RS00085 | 14690..14797 | - | 108 | WP_031790389.1 | hypothetical protein | - |
DXE36_RS00090 | 14849..15103 | + | 255 | WP_000611512.1 | phage holin | - |
DXE36_RS00095 | 15115..15870 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DXE36_RS00100 | 16061..16553 | + | 493 | Protein_20 | staphylokinase | - |
DXE36_RS00105 | 17158..17496 | + | 339 | Protein_21 | SH3 domain-containing protein | - |
DXE36_RS00110 | 18008..18358 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
DXE36_RS00115 | 18411..18671 | - | 261 | WP_001791826.1 | hypothetical protein | - |
DXE36_RS00125 | 18980..19159 | - | 180 | WP_000669789.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sak / sak / scn | 676..18358 | 17682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294204 WP_011447039.1 NZ_LT992469:14461-14637 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294204 NZ_LT992469:c14768-14629 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|