Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 709685..709902 | Replicon | chromosome |
| Accession | NZ_LT992468 | ||
| Organism | Staphylococcus aureus isolate 12_LA_293 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | DXE47_RS04155 | Protein ID | WP_001802298.1 |
| Coordinates | 709798..709902 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 709685..709740 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE47_RS04135 | 705890..706555 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
| DXE47_RS04140 | 706707..707027 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| DXE47_RS04145 | 707029..708009 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
| DXE47_RS04150 | 708275..709366 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
| - | 709685..709740 | + | 56 | - | - | Antitoxin |
| DXE47_RS04155 | 709798..709902 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| DXE47_RS04170 | 710582..710740 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| DXE47_RS04175 | 711176..711268 | + | 93 | WP_000220902.1 | hypothetical protein | - |
| DXE47_RS04180 | 711398..712255 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
| DXE47_RS04185 | 712323..713105 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
| DXE47_RS04190 | 713395..714003 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294198 WP_001802298.1 NZ_LT992468:c709902-709798 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT294198 NZ_LT992468:709685-709740 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|