Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 535952..536251 | Replicon | chromosome |
| Accession | NZ_LT992468 | ||
| Organism | Staphylococcus aureus isolate 12_LA_293 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE47_RS03150 | Protein ID | WP_011447039.1 |
| Coordinates | 536075..536251 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 535952..536007 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE47_RS03105 | 531283..531543 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DXE47_RS03110 | 531596..531946 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE47_RS03115 | 532631..533080 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE47_RS03120 | 533175..533510 | - | 336 | Protein_564 | SH3 domain-containing protein | - |
| DXE47_RS03130 | 534160..534651 | - | 492 | WP_000919350.1 | staphylokinase | - |
| DXE47_RS03135 | 534842..535597 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE47_RS03140 | 535609..535863 | - | 255 | WP_000611512.1 | phage holin | - |
| DXE47_RS03145 | 535915..536022 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 535944..536083 | + | 140 | NuclAT_0 | - | - |
| - | 535944..536083 | + | 140 | NuclAT_0 | - | - |
| - | 535944..536083 | + | 140 | NuclAT_0 | - | - |
| - | 535944..536083 | + | 140 | NuclAT_0 | - | - |
| - | 535952..536007 | + | 56 | - | - | Antitoxin |
| DXE47_RS03150 | 536075..536251 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| DXE47_RS03155 | 536401..536697 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE47_RS03160 | 536755..537042 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE47_RS03165 | 537089..537241 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE47_RS03170 | 537231..541016 | - | 3786 | WP_114621458.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 531596..584303 | 52707 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294194 WP_011447039.1 NZ_LT992468:c536251-536075 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT294194 NZ_LT992468:535952-536007 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|