Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 766874..767137 | Replicon | chromosome |
Accession | NZ_LT992467 | ||
Organism | Staphylococcus aureus isolate 16_LA_309 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DXE59_RS04095 | Protein ID | WP_001802298.1 |
Coordinates | 767033..767137 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 766874..767038 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE59_RS04075 | 763059..763724 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
DXE59_RS04080 | 763876..764196 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DXE59_RS04085 | 764198..765178 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
DXE59_RS04090 | 765444..766535 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 766874..767038 | + | 165 | - | - | Antitoxin |
DXE59_RS04095 | 767033..767137 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
DXE59_RS04110 | 767817..767975 | + | 159 | WP_001792784.1 | hypothetical protein | - |
DXE59_RS04115 | 768411..768503 | + | 93 | WP_000220902.1 | hypothetical protein | - |
DXE59_RS04120 | 768633..769490 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
DXE59_RS04125 | 769558..770340 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
DXE59_RS04130 | 770630..771238 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294185 WP_001802298.1 NZ_LT992467:c767137-767033 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT294185 NZ_LT992467:766874-767038 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|