Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 591991..592298 | Replicon | chromosome |
| Accession | NZ_LT992467 | ||
| Organism | Staphylococcus aureus isolate 16_LA_309 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A6B5C9Y4 |
| Locus tag | DXE59_RS03095 | Protein ID | WP_072357969.1 |
| Coordinates | 592122..592298 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 591991..592130 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE59_RS03040 | 587333..587593 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DXE59_RS03045 | 587646..587996 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE59_RS03050 | 588679..589128 | + | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE59_RS03055 | 589221..589555 | - | 335 | Protein_546 | SH3 domain-containing protein | - |
| DXE59_RS03075 | 590206..590697 | - | 492 | WP_000920041.1 | staphylokinase | - |
| DXE59_RS03080 | 590889..591644 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE59_RS03085 | 591656..591910 | - | 255 | WP_000611512.1 | phage holin | - |
| DXE59_RS03090 | 591962..592069 | + | 108 | WP_031762631.1 | hypothetical protein | - |
| - | 591991..592130 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 591991..592130 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 591991..592130 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 591991..592130 | + | 140 | NuclAT_0 | - | Antitoxin |
| DXE59_RS03095 | 592122..592298 | - | 177 | WP_072357969.1 | putative holin-like toxin | Toxin |
| DXE59_RS03100 | 592450..592746 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE59_RS03105 | 592804..593091 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE59_RS03110 | 593138..593290 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE59_RS03115 | 593280..597065 | - | 3786 | WP_114636066.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 587646..640141 | 52495 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6863.47 Da Isoelectric Point: 10.6777
>T294179 WP_072357969.1 NZ_LT992467:c592298-592122 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294179 NZ_LT992467:591991-592130 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|