Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 1054663..1055001 | Replicon | chromosome |
Accession | NZ_LT992466 | ||
Organism | Staphylococcus aureus isolate 4_LA_208 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DXE30_RS05340 | Protein ID | WP_011447039.1 |
Coordinates | 1054663..1054839 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1054827..1055001 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE30_RS05320 | 1049898..1053683 | + | 3786 | WP_098827734.1 | hypothetical protein | - |
DXE30_RS05325 | 1053673..1053825 | + | 153 | WP_001153681.1 | hypothetical protein | - |
DXE30_RS05330 | 1053872..1054159 | + | 288 | WP_001040261.1 | hypothetical protein | - |
DXE30_RS05335 | 1054217..1054513 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DXE30_RS05340 | 1054663..1054839 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
- | 1054827..1055001 | - | 175 | - | - | Antitoxin |
DXE30_RS05350 | 1055051..1055305 | + | 255 | WP_000611512.1 | phage holin | - |
DXE30_RS05355 | 1055317..1056072 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DXE30_RS05360 | 1056263..1056754 | + | 492 | WP_000919350.1 | staphylokinase | - |
DXE30_RS05370 | 1057359..1057697 | + | 339 | Protein_1006 | SH3 domain-containing protein | - |
DXE30_RS05375 | 1058208..1058558 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
DXE30_RS05380 | 1058611..1058871 | - | 261 | WP_001791826.1 | hypothetical protein | - |
DXE30_RS05390 | 1059182..1059361 | - | 180 | WP_000669789.1 | hypothetical protein | - |
DXE30_RS05395 | 1059683..1059930 | - | 248 | Protein_1010 | sphingomyelin phosphodiesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / hlb / sak / scn | 1007102..1058558 | 51456 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294170 WP_011447039.1 NZ_LT992466:1054663-1054839 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT294170 NZ_LT992466:c1055001-1054827 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|