Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 881438..881717 | Replicon | chromosome |
Accession | NZ_LT992466 | ||
Organism | Staphylococcus aureus isolate 4_LA_208 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DXE30_RS04350 | Protein ID | WP_001802298.1 |
Coordinates | 881438..881542 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 881538..881717 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE30_RS04315 | 877337..877945 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
DXE30_RS04320 | 878235..879017 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
DXE30_RS04325 | 879085..879942 | + | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
DXE30_RS04330 | 880072..880164 | - | 93 | WP_000220902.1 | hypothetical protein | - |
DXE30_RS04335 | 880600..880758 | - | 159 | WP_001792784.1 | hypothetical protein | - |
DXE30_RS04350 | 881438..881542 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 881538..881717 | - | 180 | - | - | Antitoxin |
DXE30_RS04355 | 882040..883131 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
DXE30_RS04360 | 883397..884377 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
DXE30_RS04365 | 884379..884699 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DXE30_RS04370 | 884851..885516 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294166 WP_001802298.1 NZ_LT992466:881438-881542 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT294166 NZ_LT992466:c881717-881538 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|