Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 2517430..2517768 | Replicon | chromosome |
Accession | NZ_LT992465 | ||
Organism | Staphylococcus aureus isolate 6_LA_232 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DXE62_RS12835 | Protein ID | WP_011447039.1 |
Coordinates | 2517430..2517606 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2517594..2517768 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE62_RS12815 | 2512665..2516450 | + | 3786 | WP_000582165.1 | hypothetical protein | - |
DXE62_RS12820 | 2516440..2516592 | + | 153 | WP_001153681.1 | hypothetical protein | - |
DXE62_RS12825 | 2516639..2516926 | + | 288 | WP_001040261.1 | hypothetical protein | - |
DXE62_RS12830 | 2516984..2517280 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DXE62_RS12835 | 2517430..2517606 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
- | 2517594..2517768 | - | 175 | - | - | Antitoxin |
DXE62_RS12845 | 2517818..2518072 | + | 255 | WP_000611512.1 | phage holin | - |
DXE62_RS12850 | 2518084..2518839 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DXE62_RS12855 | 2519030..2519521 | + | 492 | WP_000919350.1 | staphylokinase | - |
DXE62_RS12865 | 2520171..2520506 | + | 336 | Protein_2417 | SH3 domain-containing protein | - |
DXE62_RS12870 | 2520601..2521050 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
DXE62_RS12875 | 2521734..2522084 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DXE62_RS12880 | 2522137..2522397 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / hlb / sak / chp / scn | 2469666..2522084 | 52418 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294160 WP_011447039.1 NZ_LT992465:2517430-2517606 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT294160 NZ_LT992465:c2517768-2517594 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|