Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2048244..2048428 | Replicon | chromosome |
Accession | NZ_LT992465 | ||
Organism | Staphylococcus aureus isolate 6_LA_232 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DXE62_RS10220 | Protein ID | WP_000482647.1 |
Coordinates | 2048244..2048351 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2048368..2048428 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE62_RS10195 | 2043601..2044074 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
DXE62_RS10200 | 2044197..2045408 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
DXE62_RS10205 | 2045596..2046255 | - | 660 | WP_000831300.1 | hypothetical protein | - |
DXE62_RS10210 | 2046315..2047457 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
DXE62_RS10215 | 2047724..2048110 | + | 387 | WP_000779355.1 | flippase GtxA | - |
DXE62_RS10220 | 2048244..2048351 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2048368..2048428 | - | 61 | - | - | Antitoxin |
DXE62_RS10230 | 2049055..2050818 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
DXE62_RS10235 | 2050843..2052576 | + | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
DXE62_RS10245 | 2052807..2052974 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T294154 WP_000482647.1 NZ_LT992465:2048244-2048351 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT294154 NZ_LT992465:c2048428-2048368 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|