Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 2823907..2824214 | Replicon | chromosome |
Accession | NZ_LT992463 | ||
Organism | Staphylococcus aureus isolate 2_LA_86 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DXE29_RS14535 | Protein ID | WP_011447039.1 |
Coordinates | 2823907..2824083 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 2824075..2824214 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE29_RS14515 | 2819142..2822927 | + | 3786 | WP_000582165.1 | hypothetical protein | - |
DXE29_RS14520 | 2822917..2823069 | + | 153 | WP_001153681.1 | hypothetical protein | - |
DXE29_RS14525 | 2823116..2823403 | + | 288 | WP_001040261.1 | hypothetical protein | - |
DXE29_RS14530 | 2823461..2823757 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DXE29_RS14535 | 2823907..2824083 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
- | 2824075..2824214 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2824075..2824214 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2824075..2824214 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2824075..2824214 | - | 140 | NuclAT_0 | - | Antitoxin |
DXE29_RS14540 | 2824136..2824243 | - | 108 | WP_001791821.1 | hypothetical protein | - |
DXE29_RS14545 | 2824295..2824549 | + | 255 | WP_000611512.1 | phage holin | - |
DXE29_RS14550 | 2824561..2825316 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DXE29_RS14555 | 2825507..2825998 | + | 492 | WP_000919350.1 | staphylokinase | - |
DXE29_RS14565 | 2826648..2826983 | + | 336 | Protein_2696 | SH3 domain-containing protein | - |
DXE29_RS14570 | 2827078..2827527 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
DXE29_RS14575 | 2828212..2828562 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DXE29_RS14580 | 2828615..2828875 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sak / chp / scn | 2787718..2831145 | 43427 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294129 WP_011447039.1 NZ_LT992463:2823907-2824083 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294129 NZ_LT992463:c2824214-2824075 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|