Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | TMCS/- |
Location | 2933335..2933687 | Replicon | chromosome |
Accession | NZ_LT992462 | ||
Organism | Staphylococcus aureus isolate 5_3949 |
Toxin (Protein)
Gene name | MW1434 | Uniprot ID | A0A4P7P609 |
Locus tag | DXE65_RS15305 | Protein ID | WP_001025401.1 |
Coordinates | 2933335..2933580 (+) | Length | 82 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 2933549..2933687 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE65_RS15265 | 2929471..2930085 | + | 615 | WP_000191466.1 | hypothetical protein | - |
DXE65_RS15270 | 2930082..2930228 | - | 147 | WP_001013104.1 | hypothetical protein | - |
DXE65_RS15275 | 2930458..2931042 | - | 585 | WP_031886768.1 | hypothetical protein | - |
DXE65_RS15280 | 2931099..2931728 | - | 630 | WP_029549401.1 | XRE family transcriptional regulator | - |
DXE65_RS15285 | 2931882..2932109 | + | 228 | WP_015978369.1 | helix-turn-helix transcriptional regulator | - |
DXE65_RS15290 | 2932132..2932908 | + | 777 | WP_031838392.1 | Rha family transcriptional regulator | - |
DXE65_RS15295 | 2932937..2933080 | + | 144 | WP_000939498.1 | hypothetical protein | - |
DXE65_RS15300 | 2933070..2933279 | - | 210 | WP_000642492.1 | hypothetical protein | - |
DXE65_RS15305 | 2933335..2933580 | + | 246 | WP_001025401.1 | DUF2829 domain-containing protein | Toxin |
- | 2933549..2933687 | - | 139 | - | - | Antitoxin |
DXE65_RS15310 | 2933704..2933919 | + | 216 | WP_001097552.1 | hypothetical protein | - |
DXE65_RS15315 | 2933944..2934207 | + | 264 | WP_001124160.1 | helix-turn-helix domain-containing protein | - |
DXE65_RS15320 | 2934220..2934381 | + | 162 | WP_001285954.1 | DUF1270 domain-containing protein | - |
DXE65_RS15325 | 2934460..2934783 | + | 324 | WP_031914478.1 | hypothetical protein | - |
DXE65_RS15330 | 2934798..2935160 | + | 363 | WP_031914479.1 | hypothetical protein | - |
DXE65_RS15335 | 2935157..2936323 | + | 1167 | WP_031795549.1 | DUF2800 domain-containing protein | - |
DXE65_RS15340 | 2936349..2936906 | + | 558 | WP_000645042.1 | DUF2815 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2928139..2959059 | 30920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 82 a.a. Molecular weight: 9468.72 Da Isoelectric Point: 5.7783
>T294116 WP_001025401.1 NZ_LT992462:2933335-2933580 [Staphylococcus aureus]
MNIQEATKIATKNLVSMTRKDWKESHRTKILPTNDSFLQCIISNSDGTNLIRYWQPSADDLMANDWEVINPTRDQELLKQ
F
MNIQEATKIATKNLVSMTRKDWKESHRTKILPTNDSFLQCIISNSDGTNLIRYWQPSADDLMANDWEVINPTRDQELLKQ
F
Download Length: 246 bp
Antitoxin
Download Length: 139 bp
>AT294116 NZ_LT992462:c2933687-2933549 [Staphylococcus aureus]
CGTGTATGCTAGTAACACTATTTATCATGTAACAATTTCAGACAAGACTGTTGTTTACTTTGAAAATGAGTTTAAAAACA
ATTTAAAAAGTATCATTGATAGCATTTCTAAAATTGCTTCAATAATTCCTGGTCTCTAG
CGTGTATGCTAGTAACACTATTTATCATGTAACAATTTCAGACAAGACTGTTGTTTACTTTGAAAATGAGTTTAAAAACA
ATTTAAAAAGTATCATTGATAGCATTTCTAAAATTGCTTCAATAATTCCTGGTCTCTAG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|