Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1960595..1960812 | Replicon | chromosome |
Accession | NZ_LT992462 | ||
Organism | Staphylococcus aureus isolate 5_3949 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DXE65_RS10500 | Protein ID | WP_001802298.1 |
Coordinates | 1960708..1960812 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1960595..1960650 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE65_RS10480 | 1956734..1957399 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
DXE65_RS10485 | 1957551..1957871 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DXE65_RS10490 | 1957873..1958853 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
DXE65_RS10495 | 1959119..1960210 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 1960595..1960650 | + | 56 | - | - | Antitoxin |
DXE65_RS10500 | 1960708..1960812 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
DXE65_RS15545 | 1961329..1961499 | + | 171 | WP_001807897.1 | hypothetical protein | - |
DXE65_RS10515 | 1961492..1961650 | + | 159 | WP_001792784.1 | hypothetical protein | - |
DXE65_RS10520 | 1962086..1962178 | + | 93 | WP_000220902.1 | hypothetical protein | - |
DXE65_RS10525 | 1962308..1963165 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
DXE65_RS10530 | 1963233..1964015 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
DXE65_RS10535 | 1964305..1964913 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294113 WP_001802298.1 NZ_LT992462:c1960812-1960708 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT294113 NZ_LT992462:1960595-1960650 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|