Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
| Location | 1839277..1839425 | Replicon | chromosome |
| Accession | NZ_LT992462 | ||
| Organism | Staphylococcus aureus isolate 5_3949 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | DXE65_RS09850 | Protein ID | WP_011276848.1 |
| Coordinates | 1839330..1839425 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1839277..1839312 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE65_RS09820 | 1835283..1835543 | + | 261 | WP_031863946.1 | persulfide-sensing transcriptional repressor CstR | - |
| DXE65_RS09825 | 1835543..1836298 | + | 756 | WP_031863945.1 | sulfite exporter TauE/SafE family protein | - |
| DXE65_RS09830 | 1836597..1837247 | - | 651 | WP_031903407.1 | NAD(P)-dependent oxidoreductase | - |
| DXE65_RS09835 | 1837264..1837839 | - | 576 | Protein_1819 | DsbA family protein | - |
| DXE65_RS09840 | 1837960..1838388 | - | 429 | WP_031903408.1 | Rrf2 family transcriptional regulator | - |
| DXE65_RS09845 | 1838502..1838975 | - | 474 | WP_077460978.1 | thymidylate synthase | - |
| - | 1839277..1839312 | - | 36 | - | - | Antitoxin |
| DXE65_RS09850 | 1839330..1839425 | - | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| DXE65_RS09855 | 1839591..1839938 | - | 348 | WP_002467551.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| DXE65_RS09860 | 1839957..1840574 | - | 618 | WP_002467537.1 | CadD family cadmium resistance transporter | - |
| DXE65_RS15675 | 1841170..1841262 | + | 93 | WP_002499091.1 | hypothetical protein | - |
| DXE65_RS09870 | 1841396..1841626 | + | 231 | WP_031884148.1 | SHOCT domain-containing protein | - |
| DXE65_RS15625 | 1841657..1841824 | + | 168 | WP_162837505.1 | hypothetical protein | - |
| DXE65_RS09875 | 1842141..1842815 | + | 675 | WP_002512555.1 | IS6 family transposase | - |
| DXE65_RS09880 | 1842812..1843006 | - | 195 | WP_021459082.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1842141..1842815 | 674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T294108 WP_011276848.1 NZ_LT992462:c1839425-1839330 [Staphylococcus aureus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
Antitoxin
Download Length: 36 bp
>AT294108 NZ_LT992462:c1839312-1839277 [Staphylococcus aureus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
