Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 782002..782416 Replicon chromosome
Accession NZ_LT992462
Organism Staphylococcus aureus isolate 5_3949

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag DXE65_RS04020 Protein ID WP_031267622.1
Coordinates 782165..782416 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DXE65_RS15590 Protein ID WP_000028424.1
Coordinates 782002..782175 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE65_RS03975 777719..778984 - 1266 WP_031838202.1 PBSX family phage terminase large subunit -
DXE65_RS03980 778968..779348 - 381 WP_031838201.1 DNA-binding protein -
DXE65_RS03985 779696..780097 - 402 WP_000286968.1 hypothetical protein -
DXE65_RS03990 780098..780271 - 174 WP_000595258.1 transcriptional activator RinB -
DXE65_RS03995 780268..780657 - 390 WP_169538641.1 hypothetical protein -
DXE65_RS04000 780647..780883 - 237 WP_000608281.1 hypothetical protein -
DXE65_RS04005 780876..781079 - 204 WP_000141180.1 hypothetical protein -
DXE65_RS04010 781076..781282 - 207 WP_021285914.1 DUF1381 domain-containing protein -
DXE65_RS04015 781319..781825 - 507 WP_001061842.1 dUTPase -
DXE65_RS15585 781840..782001 - 162 WP_000889684.1 hypothetical protein -
DXE65_RS15590 782002..782175 - 174 WP_000028424.1 hypothetical protein Antitoxin
DXE65_RS04020 782165..782416 - 252 WP_031267622.1 DUF1024 family protein Toxin
DXE65_RS04025 782409..782716 - 308 Protein_766 hypothetical protein -
DXE65_RS04030 782713..783060 - 348 WP_000979209.1 hypothetical protein -
DXE65_RS04035 783057..783464 - 408 WP_000695770.1 hypothetical protein -
DXE65_RS04040 783467..783673 - 207 WP_021285869.1 hypothetical protein -
DXE65_RS04045 783688..783936 - 249 WP_078069534.1 hypothetical protein -
DXE65_RS04050 783936..784190 - 255 WP_021285871.1 DUF3310 domain-containing protein -
DXE65_RS04055 784190..784807 - 618 WP_021285872.1 hypothetical protein -
DXE65_RS04060 784808..784993 - 186 WP_021285873.1 DUF3113 family protein -
DXE65_RS04065 784993..785400 - 408 WP_021285874.1 RusA family crossover junction endodeoxyribonuclease -
DXE65_RS04070 785410..785631 - 222 WP_001123688.1 DUF3269 family protein -
DXE65_RS04075 785634..785849 - 216 WP_031794786.1 hypothetical protein -
DXE65_RS04080 785846..787087 - 1242 WP_114667504.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / scn / chp / sak / sea 690310..795503 105193


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9419.35 Da        Isoelectric Point: 3.9476

>T294103 WP_031267622.1 NZ_LT992462:c782416-782165 [Staphylococcus aureus]
MNNREKIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT294103 WP_000028424.1 NZ_LT992462:c782175-782002 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References