294102

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 751591..752014 Replicon chromosome
Accession NZ_LT992462
Organism Staphylococcus aureus isolate 5_3949

Toxin (Protein)


Gene name higB Uniprot ID A0A5S9I4Y6
Locus tag DXE65_RS03760 Protein ID WP_001065091.1
Coordinates 751763..752014 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E0VQM8
Locus tag DXE65_RS03755 Protein ID WP_000028422.1
Coordinates 751591..751773 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE65_RS03710 746977..748638 - 1662 WP_000625088.1 terminase large subunit -
DXE65_RS03715 748635..748979 - 345 WP_000402904.1 hypothetical protein -
DXE65_RS03720 749109..749408 - 300 WP_000988336.1 HNH endonuclease -
DXE65_RS03725 749640..750056 - 417 WP_000590122.1 hypothetical protein -
DXE65_RS03730 750084..750284 - 201 WP_000265043.1 DUF1514 family protein -
DXE65_RS03735 750284..750433 - 150 WP_000595265.1 transcriptional activator RinB -
DXE65_RS03740 750430..750816 - 387 WP_000592207.1 hypothetical protein -
DXE65_RS03745 750813..751019 - 207 WP_000195803.1 DUF1381 domain-containing protein -
DXE65_RS03750 751056..751598 - 543 WP_000185659.1 dUTP pyrophosphatase -
DXE65_RS03755 751591..751773 - 183 WP_000028422.1 hypothetical protein Antitoxin
DXE65_RS03760 751763..752014 - 252 WP_001065091.1 DUF1024 family protein Toxin
DXE65_RS15580 752007..752174 - 168 WP_001624242.1 hypothetical protein -
DXE65_RS03765 752186..752428 - 243 WP_000131366.1 hypothetical protein -
DXE65_RS03770 752432..752800 - 369 WP_000101274.1 hypothetical protein -
DXE65_RS03775 752813..753122 - 310 Protein_714 RusA family crossover junction endodeoxyribonuclease -
DXE65_RS03780 753131..753349 - 219 WP_000338531.1 hypothetical protein -
DXE65_RS03785 753356..754240 - 885 WP_000148316.1 DnaD domain protein -
DXE65_RS03790 754270..754740 - 471 WP_000934764.1 single-stranded DNA-binding protein -
DXE65_RS03795 754741..755358 - 618 WP_071621397.1 MBL fold metallo-hydrolase -
DXE65_RS03800 755439..756359 - 921 WP_000138472.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / scn / chp / sak / sea 690310..795503 105193


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9349.22 Da        Isoelectric Point: 3.9473

>T294102 WP_001065091.1 NZ_LT992462:c752014-751763 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEH

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6741.63 Da        Isoelectric Point: 4.2658

>AT294102 WP_000028422.1 NZ_LT992462:c751773-751591 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEEQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5S9I4Y6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VQM8

References