Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprA2AS/- |
| Location | 728280..728579 | Replicon | chromosome |
| Accession | NZ_LT992462 | ||
| Organism | Staphylococcus aureus isolate 5_3949 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE65_RS03610 | Protein ID | WP_011447039.1 |
| Coordinates | 728403..728579 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 728280..728335 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE65_RS03565 | 723610..723870 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DXE65_RS03570 | 723923..724273 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE65_RS03575 | 724959..725408 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE65_RS03580 | 725503..725838 | - | 336 | Protein_675 | SH3 domain-containing protein | - |
| DXE65_RS03590 | 726488..726979 | - | 492 | WP_000919350.1 | staphylokinase | - |
| DXE65_RS03595 | 727170..727925 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE65_RS03600 | 727937..728191 | - | 255 | WP_000611512.1 | phage holin | - |
| DXE65_RS03605 | 728243..728350 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 728272..728411 | + | 140 | NuclAT_0 | - | - |
| - | 728272..728411 | + | 140 | NuclAT_0 | - | - |
| - | 728272..728411 | + | 140 | NuclAT_0 | - | - |
| - | 728272..728411 | + | 140 | NuclAT_0 | - | - |
| - | 728280..728335 | + | 56 | - | - | Antitoxin |
| DXE65_RS03610 | 728403..728579 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| DXE65_RS03615 | 728688..729461 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| DXE65_RS03625 | 729882..730256 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| DXE65_RS03630 | 730312..730599 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| DXE65_RS03635 | 730646..730798 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | vWbp / scn / chp / sak / sea | 690310..795503 | 105193 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294101 WP_011447039.1 NZ_LT992462:c728579-728403 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT294101 NZ_LT992462:728280-728335 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|