Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1897100..1897514 Replicon chromosome
Accession NZ_LT992461
Organism Staphylococcus aureus isolate 8_LA_272

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag DXE60_RS10140 Protein ID WP_031867695.1
Coordinates 1897100..1897351 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DXE60_RS15140 Protein ID WP_000028424.1
Coordinates 1897341..1897514 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE60_RS10080 1893138..1893353 + 216 WP_031794786.1 hypothetical protein -
DXE60_RS10085 1893356..1893577 + 222 WP_001123688.1 DUF3269 family protein -
DXE60_RS10090 1893587..1893991 + 405 WP_031872375.1 DUF1064 domain-containing protein -
DXE60_RS10095 1893996..1894181 + 186 WP_001187243.1 DUF3113 family protein -
DXE60_RS10100 1894182..1894487 + 306 WP_000101252.1 hypothetical protein -
DXE60_RS10105 1894615..1894974 + 360 WP_031794870.1 phage protein -
DXE60_RS10110 1894974..1895231 + 258 WP_015994745.1 DUF3310 domain-containing protein -
DXE60_RS10115 1895234..1895434 + 201 WP_015994746.1 hypothetical protein -
DXE60_RS10120 1895431..1896120 + 690 WP_015994747.1 N-6 DNA methylase -
DXE60_RS10125 1896134..1896340 + 207 WP_015994748.1 hypothetical protein -
DXE60_RS10130 1896343..1896745 + 403 Protein_1858 hypothetical protein -
DXE60_RS10135 1896742..1897107 + 366 WP_031765535.1 hypothetical protein -
DXE60_RS10140 1897100..1897351 + 252 WP_031867695.1 DUF1024 family protein Toxin
DXE60_RS15140 1897341..1897514 + 174 WP_000028424.1 hypothetical protein Antitoxin
DXE60_RS15145 1897515..1897676 + 162 WP_000889682.1 hypothetical protein -
DXE60_RS10145 1897691..1898224 + 534 WP_031807824.1 dUTPase -
DXE60_RS10150 1898261..1898467 + 207 WP_031867680.1 DUF1381 domain-containing protein -
DXE60_RS10155 1898464..1898667 + 204 WP_000141259.1 hypothetical protein -
DXE60_RS10160 1898660..1898896 + 237 WP_000608283.1 hypothetical protein -
DXE60_RS10165 1898886..1899272 + 387 WP_001623479.1 hypothetical protein -
DXE60_RS10170 1899272..1899445 + 174 WP_025174881.1 transcriptional activator RinB -
DXE60_RS10175 1899446..1899847 + 402 WP_000286968.1 hypothetical protein -
DXE60_RS10185 1900200..1900694 + 495 WP_031867679.1 terminase -
DXE60_RS10190 1900687..1901895 + 1209 WP_001807202.1 PBSX family phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1881127..1925233 44106


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9377.31 Da        Isoelectric Point: 3.8051

>T294096 WP_031867695.1 NZ_LT992461:1897100-1897351 [Staphylococcus aureus]
MNNREQIEKSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT294096 WP_000028424.1 NZ_LT992461:1897341-1897514 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References