Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprG-sprF/-
Location 349395..349612 Replicon chromosome
Accession NZ_LT992461
Organism Staphylococcus aureus isolate 8_LA_272

Toxin (Protein)


Gene name SprG3 Uniprot ID Q2FWA7
Locus tag DXE60_RS02140 Protein ID WP_001802298.1
Coordinates 349508..349612 (-) Length 35 a.a.

Antitoxin (RNA)


Gene name SprF1
Locus tag -
Coordinates 349395..349450 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE60_RS02120 345534..346199 - 666 WP_001024099.1 SDR family oxidoreductase -
DXE60_RS02125 346351..346671 + 321 WP_000003759.1 Zn(II)-responsive metalloregulatory transcriptional repressor CzrA -
DXE60_RS02130 346673..347653 + 981 WP_000019735.1 CDF family zinc efflux transporter CzrB -
DXE60_RS02135 347919..349010 + 1092 WP_000495673.1 hypothetical protein -
- 349395..349450 + 56 - - Antitoxin
DXE60_RS02140 349508..349612 - 105 WP_001802298.1 hypothetical protein Toxin
DXE60_RS15055 350129..350299 + 171 WP_001807897.1 hypothetical protein -
DXE60_RS02155 350292..350450 + 159 WP_001792784.1 hypothetical protein -
DXE60_RS02160 350886..350978 + 93 WP_000220902.1 hypothetical protein -
DXE60_RS02165 351108..351965 - 858 WP_000370942.1 Cof-type HAD-IIB family hydrolase -
DXE60_RS02170 352033..352815 - 783 WP_000908191.1 ABC transporter ATP-binding protein -
DXE60_RS02175 353105..353713 - 609 WP_000101714.1 TIR domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 35 a.a.        Molecular weight: 3906.77 Da        Isoelectric Point: 5.5724

>T294089 WP_001802298.1 NZ_LT992461:c349612-349508 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK

Download         Length: 105 bp

Antitoxin


Download         Length: 56 bp

>AT294089 NZ_LT992461:349395-349450 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y9L9

Antitoxin

Download structure file

References