Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 213221..213520 | Replicon | chromosome |
| Accession | NZ_LT992461 | ||
| Organism | Staphylococcus aureus isolate 8_LA_272 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE60_RS01350 | Protein ID | WP_011447039.1 |
| Coordinates | 213344..213520 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 213221..213276 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE60_RS01290 | 208780..208959 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| DXE60_RS01300 | 209270..209530 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DXE60_RS01305 | 209582..209932 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE60_RS01310 | 210443..210778 | - | 336 | Protein_213 | SH3 domain-containing protein | - |
| DXE60_RS01330 | 211429..211920 | - | 492 | WP_031865878.1 | staphylokinase | - |
| DXE60_RS01335 | 212111..212866 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE60_RS01340 | 212878..213132 | - | 255 | WP_000611512.1 | phage holin | - |
| DXE60_RS01345 | 213184..213291 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 213213..213352 | + | 140 | NuclAT_0 | - | - |
| - | 213213..213352 | + | 140 | NuclAT_0 | - | - |
| - | 213213..213352 | + | 140 | NuclAT_0 | - | - |
| - | 213213..213352 | + | 140 | NuclAT_0 | - | - |
| - | 213221..213276 | + | 56 | - | - | Antitoxin |
| DXE60_RS01350 | 213344..213520 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| DXE60_RS01355 | 213670..213966 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE60_RS01360 | 214024..214311 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE60_RS01365 | 214358..214510 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE60_RS01370 | 214500..218285 | - | 3786 | WP_000582158.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak | 209582..249657 | 40075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294086 WP_011447039.1 NZ_LT992461:c213520-213344 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT294086 NZ_LT992461:213221-213276 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|