Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 209989..210412 Replicon chromosome
Accession NZ_LT992460
Organism Staphylococcus aureus isolate 9_LA_281

Toxin (Protein)


Gene name higB Uniprot ID A0A5S9I4Y6
Locus tag DXE39_RS01145 Protein ID WP_001065091.1
Coordinates 210161..210412 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E0VQM8
Locus tag DXE39_RS01140 Protein ID WP_000028422.1
Coordinates 209989..210171 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE39_RS01095 205374..207035 - 1662 WP_000625087.1 terminase large subunit -
DXE39_RS01100 207032..207376 - 345 WP_000402904.1 hypothetical protein -
DXE39_RS01105 207507..207806 - 300 WP_000988336.1 HNH endonuclease -
DXE39_RS01110 208038..208454 - 417 WP_000590122.1 hypothetical protein -
DXE39_RS01115 208482..208682 - 201 WP_000265043.1 DUF1514 family protein -
DXE39_RS01120 208682..208831 - 150 WP_000595265.1 transcriptional activator RinB -
DXE39_RS01125 208828..209214 - 387 WP_000592207.1 hypothetical protein -
DXE39_RS01130 209211..209417 - 207 WP_000195803.1 DUF1381 domain-containing protein -
DXE39_RS01135 209454..209996 - 543 WP_114647895.1 dUTP pyrophosphatase -
DXE39_RS01140 209989..210171 - 183 WP_000028422.1 hypothetical protein Antitoxin
DXE39_RS01145 210161..210412 - 252 WP_001065091.1 DUF1024 family protein Toxin
DXE39_RS15175 210405..210572 - 168 WP_001624242.1 hypothetical protein -
DXE39_RS01150 210584..210826 - 243 WP_000131381.1 phi PVL orf 51-like protein -
DXE39_RS01155 210830..211198 - 369 WP_000101270.1 hypothetical protein -
DXE39_RS01160 211211..211615 - 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
DXE39_RS01165 211624..211842 - 219 WP_000338528.1 hypothetical protein -
DXE39_RS01170 211849..212733 - 885 WP_000148298.1 DnaD domain protein -
DXE39_RS01175 212763..213233 - 471 WP_000934770.1 single-stranded DNA-binding protein -
DXE39_RS01180 213234..213851 - 618 WP_071621397.1 MBL fold metallo-hydrolase -
DXE39_RS01185 213932..214852 - 921 WP_000138475.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - scn / chp / sak / sea 139209..260435 121226


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9349.22 Da        Isoelectric Point: 3.9473

>T294070 WP_001065091.1 NZ_LT992460:c210412-210161 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEH

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6741.63 Da        Isoelectric Point: 4.2658

>AT294070 WP_000028422.1 NZ_LT992460:c210171-209989 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEEQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5S9I4Y6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VQM8

References