Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 186673..186980 | Replicon | chromosome |
| Accession | NZ_LT992460 | ||
| Organism | Staphylococcus aureus isolate 9_LA_281 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE39_RS00995 | Protein ID | WP_011447039.1 |
| Coordinates | 186804..186980 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 186673..186812 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE39_RS00950 | 182011..182271 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DXE39_RS00955 | 182324..182674 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE39_RS00960 | 183360..183809 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE39_RS00965 | 183904..184239 | - | 336 | Protein_181 | SH3 domain-containing protein | - |
| DXE39_RS00975 | 184889..185380 | - | 492 | WP_000919350.1 | staphylokinase | - |
| DXE39_RS00980 | 185571..186326 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE39_RS00985 | 186338..186592 | - | 255 | WP_000611512.1 | phage holin | - |
| DXE39_RS00990 | 186644..186751 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 186673..186812 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 186673..186812 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 186673..186812 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 186673..186812 | + | 140 | NuclAT_0 | - | Antitoxin |
| DXE39_RS00995 | 186804..186980 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| DXE39_RS01000 | 187089..187862 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| DXE39_RS01010 | 188283..188657 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| DXE39_RS01015 | 188713..189000 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| DXE39_RS01020 | 189047..189199 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | scn / chp / sak / sea | 139209..260435 | 121226 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294067 WP_011447039.1 NZ_LT992460:c186980-186804 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294067 NZ_LT992460:186673-186812 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|