Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 1405243..1405581 | Replicon | chromosome |
Accession | NZ_LT992458 | ||
Organism | Staphylococcus aureus isolate 7_4623 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A6B5C9Y4 |
Locus tag | DXE63_RS07300 | Protein ID | WP_072357969.1 |
Coordinates | 1405243..1405419 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1405407..1405581 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE63_RS07280 | 1400476..1404261 | + | 3786 | WP_114621343.1 | hypothetical protein | - |
DXE63_RS07285 | 1404251..1404403 | + | 153 | WP_001153681.1 | hypothetical protein | - |
DXE63_RS07290 | 1404450..1404737 | + | 288 | WP_052997141.1 | hypothetical protein | - |
DXE63_RS07295 | 1404795..1405091 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DXE63_RS07300 | 1405243..1405419 | + | 177 | WP_072357969.1 | putative holin-like toxin | Toxin |
- | 1405407..1405581 | - | 175 | - | - | Antitoxin |
DXE63_RS07310 | 1405631..1405885 | + | 255 | WP_000611512.1 | phage holin | - |
DXE63_RS07315 | 1405897..1406652 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DXE63_RS07320 | 1406843..1407334 | + | 492 | WP_052997142.1 | staphylokinase | - |
DXE63_RS07340 | 1407985..1408319 | + | 335 | Protein_1364 | SH3 domain-containing protein | - |
DXE63_RS07345 | 1408412..1408861 | - | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
DXE63_RS07350 | 1409544..1409894 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
DXE63_RS07355 | 1409947..1410207 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / hlb / sak / chp / scn | 1357274..1409894 | 52620 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6863.47 Da Isoelectric Point: 10.6777
>T294058 WP_072357969.1 NZ_LT992458:1405243-1405419 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT294058 NZ_LT992458:c1405581-1405407 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|