Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1218251..1218530 | Replicon | chromosome |
Accession | NZ_LT992458 | ||
Organism | Staphylococcus aureus isolate 7_4623 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DXE63_RS06215 | Protein ID | WP_001802298.1 |
Coordinates | 1218251..1218355 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1218351..1218530 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE63_RS06180 | 1214150..1214758 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
DXE63_RS06185 | 1215048..1215830 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
DXE63_RS06190 | 1215898..1216755 | + | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
DXE63_RS06195 | 1216885..1216977 | - | 93 | WP_000220902.1 | hypothetical protein | - |
DXE63_RS06200 | 1217413..1217571 | - | 159 | WP_001792784.1 | hypothetical protein | - |
DXE63_RS06215 | 1218251..1218355 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 1218351..1218530 | - | 180 | - | - | Antitoxin |
DXE63_RS06220 | 1218853..1219944 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
DXE63_RS06225 | 1220210..1221190 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
DXE63_RS06230 | 1221192..1221512 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DXE63_RS06235 | 1221664..1222329 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294054 WP_001802298.1 NZ_LT992458:1218251-1218355 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT294054 NZ_LT992458:c1218530-1218351 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|