Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 922523..922707 | Replicon | chromosome |
Accession | NZ_LT992458 | ||
Organism | Staphylococcus aureus isolate 7_4623 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DXE63_RS04595 | Protein ID | WP_000482647.1 |
Coordinates | 922523..922630 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 922647..922707 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE63_RS04570 | 917880..918353 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
DXE63_RS04575 | 918476..919687 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
DXE63_RS04580 | 919875..920534 | - | 660 | WP_000831300.1 | hypothetical protein | - |
DXE63_RS04585 | 920594..921736 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
DXE63_RS04590 | 922003..922389 | + | 387 | WP_000779355.1 | flippase GtxA | - |
DXE63_RS04595 | 922523..922630 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 922647..922707 | - | 61 | - | - | Antitoxin |
DXE63_RS04605 | 923334..925097 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
DXE63_RS04610 | 925122..926855 | + | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
DXE63_RS04620 | 927086..927253 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T294052 WP_000482647.1 NZ_LT992458:922523-922630 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT294052 NZ_LT992458:c922707-922647 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|