Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2099676..2100014 | Replicon | chromosome |
| Accession | NZ_LT992456 | ||
| Organism | Staphylococcus aureus isolate 1_1439 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE58_RS10735 | Protein ID | WP_011447039.1 |
| Coordinates | 2099676..2099852 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2099840..2100014 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE58_RS10715 | 2094911..2098696 | + | 3786 | WP_000582165.1 | hypothetical protein | - |
| DXE58_RS10720 | 2098686..2098838 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE58_RS10725 | 2098885..2099172 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE58_RS10730 | 2099230..2099526 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE58_RS10735 | 2099676..2099852 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| - | 2099840..2100014 | - | 175 | - | - | Antitoxin |
| DXE58_RS10745 | 2100064..2100318 | + | 255 | WP_000611512.1 | phage holin | - |
| DXE58_RS10750 | 2100330..2101085 | + | 756 | WP_064131634.1 | CHAP domain-containing protein | - |
| DXE58_RS10755 | 2101276..2101767 | + | 492 | WP_000919350.1 | staphylokinase | - |
| DXE58_RS10765 | 2102417..2102752 | + | 336 | Protein_2004 | SH3 domain-containing protein | - |
| DXE58_RS10770 | 2102847..2103297 | - | 451 | Protein_2005 | chemotaxis-inhibiting protein CHIPS | - |
| DXE58_RS10775 | 2103982..2104332 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE58_RS10780 | 2104385..2104645 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sak / chp / scn | 2052708..2104332 | 51624 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294042 WP_011447039.1 NZ_LT992456:2099676-2099852 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT294042 NZ_LT992456:c2100014-2099840 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|