Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1927112..1927375 | Replicon | chromosome |
Accession | NZ_LT992456 | ||
Organism | Staphylococcus aureus isolate 1_1439 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DXE58_RS09740 | Protein ID | WP_001802298.1 |
Coordinates | 1927112..1927216 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 1927211..1927375 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE58_RS09705 | 1923011..1923619 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
DXE58_RS09710 | 1923909..1924691 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
DXE58_RS09715 | 1924759..1925616 | + | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
DXE58_RS09720 | 1925746..1925838 | - | 93 | WP_000220902.1 | hypothetical protein | - |
DXE58_RS09725 | 1926274..1926432 | - | 159 | WP_001792784.1 | hypothetical protein | - |
DXE58_RS09740 | 1927112..1927216 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 1927211..1927375 | - | 165 | - | - | Antitoxin |
DXE58_RS09745 | 1927648..1928739 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
DXE58_RS09750 | 1929005..1929985 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
DXE58_RS09755 | 1929987..1930307 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DXE58_RS09760 | 1930459..1931124 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294037 WP_001802298.1 NZ_LT992456:1927112-1927216 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT294037 NZ_LT992456:c1927375-1927211 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|