Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1631275..1631459 | Replicon | chromosome |
Accession | NZ_LT992456 | ||
Organism | Staphylococcus aureus isolate 1_1439 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DXE58_RS08115 | Protein ID | WP_000482647.1 |
Coordinates | 1631275..1631382 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1631399..1631459 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE58_RS08090 | 1626632..1627105 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
DXE58_RS08095 | 1627228..1628439 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
DXE58_RS08100 | 1628627..1629286 | - | 660 | WP_000831300.1 | hypothetical protein | - |
DXE58_RS08105 | 1629346..1630488 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
DXE58_RS08110 | 1630755..1631141 | + | 387 | WP_000779355.1 | flippase GtxA | - |
DXE58_RS08115 | 1631275..1631382 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1631399..1631459 | - | 61 | - | - | Antitoxin |
DXE58_RS08125 | 1632086..1633849 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
DXE58_RS08130 | 1633874..1635607 | + | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
DXE58_RS08140 | 1635838..1636005 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T294036 WP_000482647.1 NZ_LT992456:1631275-1631382 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT294036 NZ_LT992456:c1631459-1631399 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|