Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 1446562..1446746 | Replicon | chromosome |
| Accession | NZ_LT992436 | ||
| Organism | Staphylococcus aureus isolate 1549-REV | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | DYY98_RS07620 | Protein ID | WP_000482647.1 |
| Coordinates | 1446639..1446746 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1446562..1446622 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DYY98_RS07600 | 1442149..1442316 | - | 168 | WP_031785511.1 | hypothetical protein | - |
| DYY98_RS07610 | 1442547..1444279 | - | 1733 | Protein_1406 | ABC transporter ATP-binding protein | - |
| DYY98_RS07615 | 1444328..1446067 | - | 1740 | WP_115657082.1 | ABC transporter ATP-binding protein/permease | - |
| DYY98_RS14050 | 1446445..1446612 | - | 168 | WP_000301894.1 | hypothetical protein | - |
| - | 1446562..1446622 | + | 61 | - | - | Antitoxin |
| DYY98_RS07620 | 1446639..1446746 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| DYY98_RS07625 | 1446880..1447266 | - | 387 | WP_000779354.1 | flippase GtxA | - |
| DYY98_RS07630 | 1447534..1448676 | + | 1143 | WP_001176860.1 | glycerate kinase | - |
| DYY98_RS07635 | 1448736..1449395 | + | 660 | WP_000831298.1 | membrane protein | - |
| DYY98_RS07640 | 1449575..1450786 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
| DYY98_RS07645 | 1450909..1451382 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T294029 WP_000482647.1 NZ_LT992436:c1446746-1446639 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT294029 NZ_LT992436:1446562-1446622 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|