Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1446561..1446745 | Replicon | chromosome |
Accession | NZ_LT992435 | ||
Organism | Staphylococcus aureus isolate 1549-SCV |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DYY96_RS07620 | Protein ID | WP_000482647.1 |
Coordinates | 1446638..1446745 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1446561..1446621 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY96_RS07600 | 1442148..1442315 | - | 168 | WP_031785511.1 | hypothetical protein | - |
DYY96_RS07610 | 1442546..1444278 | - | 1733 | Protein_1407 | ABC transporter ATP-binding protein | - |
DYY96_RS07615 | 1444327..1446066 | - | 1740 | WP_115657082.1 | ABC transporter ATP-binding protein/permease | - |
DYY96_RS14055 | 1446444..1446611 | - | 168 | WP_000301894.1 | hypothetical protein | - |
- | 1446561..1446621 | + | 61 | - | - | Antitoxin |
DYY96_RS07620 | 1446638..1446745 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DYY96_RS07625 | 1446879..1447265 | - | 387 | WP_000779354.1 | flippase GtxA | - |
DYY96_RS07630 | 1447533..1448675 | + | 1143 | WP_001176860.1 | glycerate kinase | - |
DYY96_RS07635 | 1448735..1449394 | + | 660 | WP_000831298.1 | membrane protein | - |
DYY96_RS07640 | 1449574..1450785 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
DYY96_RS07645 | 1450908..1451381 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T294021 WP_000482647.1 NZ_LT992435:c1446745-1446638 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT294021 NZ_LT992435:1446561-1446621 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|