Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 990770..991077 | Replicon | chromosome |
Accession | NZ_LT992435 | ||
Organism | Staphylococcus aureus isolate 1549-SCV |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DYY96_RS05120 | Protein ID | WP_011447039.1 |
Coordinates | 990901..991077 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 990770..990909 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY96_RS05075 | 986109..986369 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DYY96_RS05080 | 986422..986772 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DYY96_RS05085 | 987457..987906 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
DYY96_RS05090 | 988001..988336 | - | 336 | Protein_937 | SH3 domain-containing protein | - |
DYY96_RS05100 | 988986..989477 | - | 492 | WP_000919350.1 | staphylokinase | - |
DYY96_RS05105 | 989668..990423 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DYY96_RS05110 | 990435..990689 | - | 255 | WP_000611512.1 | phage holin | - |
DYY96_RS05115 | 990741..990848 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 990770..990909 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 990770..990909 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 990770..990909 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 990770..990909 | + | 140 | NuclAT_0 | - | Antitoxin |
DYY96_RS05120 | 990901..991077 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
DYY96_RS05125 | 991227..991523 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DYY96_RS05130 | 991581..991868 | - | 288 | WP_001040261.1 | hypothetical protein | - |
DYY96_RS05135 | 991915..992067 | - | 153 | WP_001153681.1 | hypothetical protein | - |
DYY96_RS05140 | 992057..995842 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 986422..1036704 | 50282 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294017 WP_011447039.1 NZ_LT992435:c991077-990901 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294017 NZ_LT992435:990770-990909 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|