Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1446556..1446740 | Replicon | chromosome |
Accession | NZ_LT992434 | ||
Organism | Staphylococcus aureus isolate 1549-WT |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DYY92_RS07625 | Protein ID | WP_000482647.1 |
Coordinates | 1446633..1446740 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1446556..1446616 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY92_RS07605 | 1442143..1442310 | - | 168 | WP_031785511.1 | hypothetical protein | - |
DYY92_RS07615 | 1442541..1444273 | - | 1733 | Protein_1406 | ABC transporter ATP-binding protein | - |
DYY92_RS07620 | 1444322..1446061 | - | 1740 | WP_115657082.1 | ABC transporter ATP-binding protein/permease | - |
DYY92_RS14060 | 1446439..1446606 | - | 168 | WP_000301894.1 | hypothetical protein | - |
- | 1446556..1446616 | + | 61 | - | - | Antitoxin |
DYY92_RS07625 | 1446633..1446740 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DYY92_RS07630 | 1446874..1447260 | - | 387 | WP_000779354.1 | flippase GtxA | - |
DYY92_RS07635 | 1447528..1448670 | + | 1143 | WP_001176860.1 | glycerate kinase | - |
DYY92_RS07640 | 1448730..1449389 | + | 660 | WP_000831298.1 | membrane protein | - |
DYY92_RS07645 | 1449569..1450780 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
DYY92_RS07650 | 1450903..1451376 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T294013 WP_000482647.1 NZ_LT992434:c1446740-1446633 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT294013 NZ_LT992434:1446556-1446616 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|