Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 990764..991071 | Replicon | chromosome |
| Accession | NZ_LT992434 | ||
| Organism | Staphylococcus aureus isolate 1549-WT | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DYY92_RS05120 | Protein ID | WP_011447039.1 |
| Coordinates | 990895..991071 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 990764..990903 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DYY92_RS05075 | 986103..986363 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DYY92_RS05080 | 986416..986766 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DYY92_RS05085 | 987451..987900 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DYY92_RS05090 | 987995..988330 | - | 336 | Protein_936 | SH3 domain-containing protein | - |
| DYY92_RS05100 | 988980..989471 | - | 492 | WP_000919350.1 | staphylokinase | - |
| DYY92_RS05105 | 989662..990417 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DYY92_RS05110 | 990429..990683 | - | 255 | WP_000611512.1 | phage holin | - |
| DYY92_RS05115 | 990735..990842 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 990764..990903 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 990764..990903 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 990764..990903 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 990764..990903 | + | 140 | NuclAT_0 | - | Antitoxin |
| DYY92_RS05120 | 990895..991071 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| DYY92_RS05125 | 991221..991517 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DYY92_RS05130 | 991575..991862 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| DYY92_RS05135 | 991909..992061 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| DYY92_RS05140 | 992051..995836 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 986416..1036698 | 50282 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294009 WP_011447039.1 NZ_LT992434:c991071-990895 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294009 NZ_LT992434:990764-990903 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|