Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3179500..3180084 | Replicon | chromosome |
Accession | NZ_LT985188 | ||
Organism | Micropruina glycogenica isolate |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | MPLG2_RS14940 | Protein ID | WP_105186822.1 |
Coordinates | 3179803..3180084 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MPLG2_RS14935 | Protein ID | WP_105186821.1 |
Coordinates | 3179500..3179793 (-) | Length | 98 a.a. |
Genomic Context
Location: 3181365..3181799 (435 bp)
Type: Others
Protein ID: WP_197709966.1
Type: Others
Protein ID: WP_197709966.1
Location: 3182494..3182832 (339 bp)
Type: Others
Protein ID: WP_105186826.1
Type: Others
Protein ID: WP_105186826.1
Location: 3183355..3183624 (270 bp)
Type: Others
Protein ID: WP_197709968.1
Type: Others
Protein ID: WP_197709968.1
Location: 3175793..3176755 (963 bp)
Type: Others
Protein ID: WP_105186819.1
Type: Others
Protein ID: WP_105186819.1
Location: 3176755..3176979 (225 bp)
Type: Others
Protein ID: WP_105186820.1
Type: Others
Protein ID: WP_105186820.1
Location: 3177165..3179426 (2262 bp)
Type: Others
Protein ID: WP_197709965.1
Type: Others
Protein ID: WP_197709965.1
Location: 3179500..3179793 (294 bp)
Type: Antitoxin
Protein ID: WP_105186821.1
Type: Antitoxin
Protein ID: WP_105186821.1
Location: 3179803..3180084 (282 bp)
Type: Toxin
Protein ID: WP_105186822.1
Type: Toxin
Protein ID: WP_105186822.1
Location: 3180081..3181232 (1152 bp)
Type: Others
Protein ID: WP_105186823.1
Type: Others
Protein ID: WP_105186823.1
Location: 3181927..3182412 (486 bp)
Type: Others
Protein ID: WP_105186825.1
Type: Others
Protein ID: WP_105186825.1
Location: 3182837..3183262 (426 bp)
Type: Others
Protein ID: WP_197709967.1
Type: Others
Protein ID: WP_197709967.1
Location: 3183654..3184829 (1176 bp)
Type: Others
Protein ID: WP_105186828.1
Type: Others
Protein ID: WP_105186828.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MPLG2_RS14920 | 3175793..3176755 | - | 963 | WP_105186819.1 | hypothetical protein | - |
MPLG2_RS14925 | 3176755..3176979 | - | 225 | WP_105186820.1 | hypothetical protein | - |
MPLG2_RS14930 | 3177165..3179426 | - | 2262 | WP_197709965.1 | formylglycine-generating enzyme family protein | - |
MPLG2_RS14935 | 3179500..3179793 | - | 294 | WP_105186821.1 | HigA family addiction module antidote protein | Antitoxin |
MPLG2_RS14940 | 3179803..3180084 | - | 282 | WP_105186822.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MPLG2_RS14945 | 3180081..3181232 | - | 1152 | WP_105186823.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
MPLG2_RS14950 | 3181365..3181799 | + | 435 | WP_197709966.1 | excisionase family DNA-binding protein | - |
MPLG2_RS14955 | 3181927..3182412 | - | 486 | WP_105186825.1 | MarR family transcriptional regulator | - |
MPLG2_RS14960 | 3182494..3182832 | + | 339 | WP_105186826.1 | hypothetical protein | - |
MPLG2_RS14965 | 3182837..3183262 | - | 426 | WP_197709967.1 | hypothetical protein | - |
MPLG2_RS14970 | 3183355..3183624 | + | 270 | WP_197709968.1 | class I SAM-dependent methyltransferase | - |
MPLG2_RS14975 | 3183654..3184829 | - | 1176 | WP_105186828.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10910.40 Da Isoelectric Point: 8.0513
>T293963 WP_105186822.1 NZ_LT985188:c3180084-3179803 [Micropruina glycogenica]
VIRSFRDSATERLWSRQRVKTIDPRIERAALRKLVMLDAAETLDDLRVPPGNRLEELRGDRAGQHSIRINQQWRICFTWT
DAGPIDVEIVDYH
VIRSFRDSATERLWSRQRVKTIDPRIERAALRKLVMLDAAETLDDLRVPPGNRLEELRGDRAGQHSIRINQQWRICFTWT
DAGPIDVEIVDYH
Download Length: 282 bp