Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5974885..5975480 | Replicon | chromosome |
Accession | NZ_LT969520 | ||
Organism | Pseudomonas aeruginosa isolate RW109 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | RW109_RS32230 | Protein ID | WP_003117425.1 |
Coordinates | 5975202..5975480 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | RW109_RS32225 | Protein ID | WP_003099268.1 |
Coordinates | 5974885..5975190 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RW109_RS32190 | 5970024..5970872 | + | 849 | WP_003162406.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
RW109_RS32200 | 5971039..5971980 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
RW109_RS32205 | 5972097..5972711 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
RW109_RS32210 | 5972753..5973337 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
RW109_RS32215 | 5973378..5974478 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
RW109_RS32225 | 5974885..5975190 | - | 306 | WP_003099268.1 | HigA family addiction module antidote protein | Antitoxin |
RW109_RS32230 | 5975202..5975480 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
RW109_RS32240 | 5975805..5978033 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
RW109_RS32245 | 5978103..5978750 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
RW109_RS32250 | 5978812..5980050 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T293951 WP_003117425.1 NZ_LT969520:c5975480-5975202 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|