Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 2437496..2437653 Replicon chromosome
Accession NZ_LT963436
Organism Staphylococcus saprophyticus isolate Staphylococcus saprophyticus 883

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag DG022_RS12005 Protein ID WP_002441941.1
Coordinates 2437558..2437653 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 2437496..2437529 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG022_RS11980 2433283..2434116 + 834 WP_069795006.1 aldo/keto reductase -
DG022_RS11985 2434583..2434882 - 300 WP_011304021.1 hypothetical protein -
DG022_RS11990 2435259..2435492 + 234 WP_011304022.1 ferrous iron transport protein A -
DG022_RS11995 2435553..2435618 - 66 WP_108866175.1 type I toxin-antitoxin system Fst family toxin -
DG022_RS12000 2435806..2437200 - 1395 WP_078073159.1 RES family NAD+ phosphorylase -
- 2437496..2437529 + 34 - - Antitoxin
DG022_RS12005 2437558..2437653 - 96 WP_002441941.1 type I toxin-antitoxin system Fst family toxin Toxin
DG022_RS12010 2437956..2438714 - 759 WP_069795223.1 MerR family transcriptional regulator -
DG022_RS12015 2438824..2439387 - 564 WP_047505113.1 helix-turn-helix domain-containing protein -
DG022_RS12020 2439581..2441038 - 1458 WP_011304026.1 carbon starvation protein A -
DG022_RS12025 2441246..2442085 - 840 WP_002481957.1 ParB/RepB/Spo0J family partition protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3560.34 Da        Isoelectric Point: 9.9256

>T293941 WP_002441941.1 NZ_LT963436:c2437653-2437558 [Staphylococcus saprophyticus]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK

Download         Length: 96 bp

Antitoxin


Download         Length: 34 bp

>AT293941 NZ_LT963436:2437496-2437529 [Staphylococcus saprophyticus]
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References