Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 180170..180763 | Replicon | chromosome |
| Accession | NZ_LT963408 | ||
| Organism | Pseudomonas syringae group genomosp. 3 isolate CFBP6411 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | C6H37_RS00945 | Protein ID | WP_005739894.1 |
| Coordinates | 180170..180448 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | Q88B19 |
| Locus tag | C6H37_RS00950 | Protein ID | WP_005739893.1 |
| Coordinates | 180458..180763 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H37_RS00925 | 175322..176155 | - | 834 | WP_005739898.1 | transporter substrate-binding domain-containing protein | - |
| C6H37_RS00930 | 176183..177055 | - | 873 | WP_005613618.1 | phytanoyl-CoA dioxygenase family protein | - |
| C6H37_RS00935 | 177080..178600 | - | 1521 | WP_005739897.1 | amino acid ABC transporter permease/ATP-binding protein | - |
| C6H37_RS00940 | 179085..179999 | + | 915 | WP_019332092.1 | LysR family transcriptional regulator | - |
| C6H37_RS00945 | 180170..180448 | + | 279 | WP_005739894.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| C6H37_RS00950 | 180458..180763 | + | 306 | WP_005739893.1 | HigA family addiction module antidote protein | Antitoxin |
| C6H37_RS00955 | 180797..181078 | - | 282 | WP_005739892.1 | accessory factor UbiK family protein | - |
| C6H37_RS00965 | 181498..181836 | + | 339 | WP_002555808.1 | P-II family nitrogen regulator | - |
| C6H37_RS00970 | 181871..183208 | + | 1338 | WP_005739890.1 | ammonium transporter | - |
| C6H37_RS00980 | 183451..183876 | + | 426 | WP_005739889.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
| C6H37_RS00985 | 183975..184307 | + | 333 | WP_003377934.1 | hypothetical protein | - |
| C6H37_RS00990 | 184382..185074 | - | 693 | WP_005739888.1 | HAD family hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10411.07 Da Isoelectric Point: 9.1490
>T293923 WP_005739894.1 NZ_LT963408:180170-180448 [Pseudomonas syringae group genomosp. 3]
MIVSFKCVHTRYLFLQGKTRLLPSIKSVAERKLAMLDAATSILDLRSPPGNRLEALDGSRSGQYSVRINAQFRICFVWSI
NGPEDVEIVDYH
MIVSFKCVHTRYLFLQGKTRLLPSIKSVAERKLAMLDAATSILDLRSPPGNRLEALDGSRSGQYSVRINAQFRICFVWSI
NGPEDVEIVDYH
Download Length: 279 bp
Antitoxin
Download Length: 102 a.a. Molecular weight: 11158.01 Da Isoelectric Point: 7.7509
>AT293923 WP_005739893.1 NZ_LT963408:180458-180763 [Pseudomonas syringae group genomosp. 3]
MNKNGMRPVHPGEVLKEEYLEPMGLTAAALARALKVSTPTVNDIVLQRRGVSADVALRLAVCLETSPEFWLNLQLAYDLR
KAETEKGAQIREQVKCLAHCA
MNKNGMRPVHPGEVLKEEYLEPMGLTAAALARALKVSTPTVNDIVLQRRGVSADVALRLAVCLETSPEFWLNLQLAYDLR
KAETEKGAQIREQVKCLAHCA
Download Length: 306 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|