Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 181751..182344 | Replicon | chromosome |
| Accession | NZ_LT963402 | ||
| Organism | Pseudomonas syringae pv. avii isolate CFBP3846 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | Q88B20 |
| Locus tag | C6H38_RS00905 | Protein ID | WP_011103035.1 |
| Coordinates | 181751..182029 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | Q88B19 |
| Locus tag | C6H38_RS00910 | Protein ID | WP_005739893.1 |
| Coordinates | 182039..182344 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H38_RS00885 | 177012..178250 | - | 1239 | WP_060414024.1 | diaminopimelate decarboxylase | - |
| C6H38_RS00890 | 178252..179127 | - | 876 | WP_060414023.1 | DMT family transporter | - |
| C6H38_RS00895 | 179127..180410 | - | 1284 | WP_060414022.1 | lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein | - |
| C6H38_RS00900 | 180565..181500 | + | 936 | WP_005739904.1 | LysR family transcriptional regulator | - |
| C6H38_RS00905 | 181751..182029 | + | 279 | WP_011103035.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| C6H38_RS00910 | 182039..182344 | + | 306 | WP_005739893.1 | HigA family addiction module antidote protein | Antitoxin |
| C6H38_RS00915 | 182378..182659 | - | 282 | WP_005768515.1 | accessory factor UbiK family protein | - |
| C6H38_RS00925 | 183079..183417 | + | 339 | WP_002555808.1 | P-II family nitrogen regulator | - |
| C6H38_RS00930 | 183453..184790 | + | 1338 | WP_005739890.1 | ammonium transporter | - |
| C6H38_RS00940 | 185033..185460 | + | 428 | Protein_175 | YjbQ family protein | - |
| C6H38_RS00945 | 185559..185891 | + | 333 | WP_007246533.1 | hypothetical protein | - |
| C6H38_RS00950 | 185966..186658 | - | 693 | WP_007246534.1 | HAD family hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10453.11 Da Isoelectric Point: 9.1490
>T293904 WP_011103035.1 NZ_LT963402:181751-182029 [Pseudomonas syringae pv. avii]
MIVSFKCVHTRYLFLQGKTRLWPSIKSVAERKLAMLDAATSILDLRSPPGNRLEALDGSRSGQYSVRINAPFRICFVWSI
NGPEDVEIVDYH
MIVSFKCVHTRYLFLQGKTRLWPSIKSVAERKLAMLDAATSILDLRSPPGNRLEALDGSRSGQYSVRINAPFRICFVWSI
NGPEDVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q88B20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K8LYY6 |