Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 529899..530529 | Replicon | chromosome |
Accession | NZ_LT962688 | ||
Organism | Methylorubrum extorquens strain TK 0001 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | TK0001_RS02700 | Protein ID | WP_056505670.1 |
Coordinates | 530203..530529 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | TK0001_RS02695 | Protein ID | WP_015952796.1 |
Coordinates | 529899..530192 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
TK0001_RS02670 | 525957..526436 | - | 480 | WP_056505677.1 | YaiI/YqxD family protein | - |
TK0001_RS02675 | 526433..527593 | - | 1161 | WP_056505674.1 | lipid-A-disaccharide synthase | - |
TK0001_RS02680 | 527590..528440 | - | 851 | Protein_524 | UDP-2,3-diacylglucosamine diphosphatase LpxI | - |
TK0001_RS02685 | 528474..529259 | - | 786 | Protein_525 | acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase | - |
TK0001_RS02690 | 529265..529726 | - | 462 | WP_003603892.1 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
TK0001_RS02695 | 529899..530192 | - | 294 | WP_015952796.1 | transcriptional regulator | Antitoxin |
TK0001_RS02700 | 530203..530529 | - | 327 | WP_056505670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
TK0001_RS02705 | 530624..531850 | - | 1227 | WP_101475399.1 | molybdopterin molybdotransferase MoeA | - |
TK0001_RS02710 | 531847..532332 | - | 486 | WP_012255726.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
TK0001_RS02715 | 532329..533186 | - | 858 | WP_056505666.1 | indole-3-glycerol phosphate synthase TrpC | - |
TK0001_RS02720 | 533220..534233 | - | 1014 | WP_056505664.1 | anthranilate phosphoribosyltransferase | - |
TK0001_RS02725 | 534322..534924 | - | 603 | WP_056505660.1 | aminodeoxychorismate/anthranilate synthase component II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11548.40 Da Isoelectric Point: 9.0031
>T293863 WP_056505670.1 NZ_LT962688:c530529-530203 [Methylorubrum extorquens]
MADALHTVIETEIYLRSAERLMIEAERAAVVDILAADPFAGDVIPGTGGLRKVRVPLNGRGKRGGARVITCFVSARGVYL
LLAYAKNEQANPTPAQAQGLARLVDTLF
MADALHTVIETEIYLRSAERLMIEAERAAVVDILAADPFAGDVIPGTGGLRKVRVPLNGRGKRGGARVITCFVSARGVYL
LLAYAKNEQANPTPAQAQGLARLVDTLF
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|