Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 67198..67937 | Replicon | plasmid P |
| Accession | NZ_LT960613 | ||
| Organism | Vibrio tapetis subsp. tapetis isolate Vibrio tapetis CECT4600 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | VTAP4600_RS25665 | Protein ID | WP_102523759.1 |
| Coordinates | 67623..67937 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | VTAP4600_RS25660 | Protein ID | WP_012397051.1 |
| Coordinates | 67198..67614 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VTAP4600_RS25620 | 62574..62870 | - | 297 | WP_012397042.1 | hypothetical protein | - |
| VTAP4600_RS25630 | 63134..63598 | - | 465 | WP_012397044.1 | hypothetical protein | - |
| VTAP4600_RS25635 | 63614..64084 | - | 471 | WP_012397045.1 | hypothetical protein | - |
| VTAP4600_RS25640 | 64610..64846 | - | 237 | WP_102523757.1 | DinI-like family protein | - |
| VTAP4600_RS25860 | 64986..65195 | - | 210 | WP_012397048.1 | hypothetical protein | - |
| VTAP4600_RS25645 | 65535..66137 | + | 603 | WP_012397049.1 | DUF2913 family protein | - |
| VTAP4600_RS25650 | 66185..66334 | + | 150 | Protein_62 | Rpn family recombination-promoting nuclease/putative transposase | - |
| VTAP4600_RS25655 | 66386..67102 | - | 717 | Protein_63 | IS6 family transposase | - |
| VTAP4600_RS25660 | 67198..67614 | - | 417 | WP_012397051.1 | helix-turn-helix domain-containing protein | Antitoxin |
| VTAP4600_RS25665 | 67623..67937 | - | 315 | WP_102523759.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| VTAP4600_RS25670 | 68137..68748 | + | 612 | WP_102524025.1 | recombinase family protein | - |
| VTAP4600_RS25680 | 69525..70388 | + | 864 | WP_012397054.1 | endonuclease/exonuclease/phosphatase family protein | - |
| VTAP4600_RS25685 | 70575..71312 | + | 738 | WP_012397055.1 | IS6 family transposase | - |
| VTAP4600_RS25690 | 71589..72565 | + | 977 | Protein_69 | IS5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..82266 | 82266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12187.27 Da Isoelectric Point: 10.2097
>T293856 WP_102523759.1 NZ_LT960613:c67937-67623 [Vibrio tapetis subsp. tapetis]
MHVISKRPFNDAKKNFPTCAEALDAAYKVLRISRAKTPEELKALFPSLDNCKYRDKLYVIDIGGNKLRLMAYIEFTQGRF
YVKHIVTHAEYDKIIKSYRSEKKK
MHVISKRPFNDAKKNFPTCAEALDAAYKVLRISRAKTPEELKALFPSLDNCKYRDKLYVIDIGGNKLRLMAYIEFTQGRF
YVKHIVTHAEYDKIIKSYRSEKKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 16024.27 Da Isoelectric Point: 3.9904
>AT293856 WP_012397051.1 NZ_LT960613:c67614-67198 [Vibrio tapetis subsp. tapetis]
MNITRMKEFSNQMIEVMPWINGISTSDEYDQLIELMDELVEDYEGNQVLIDLLFPVIERYESESEEFNEFNRVVGELEPG
LAMLRVIIDQNEMTLSDFKDEIGAKSTVSMILSGSRSLTLRHIKSLSERFNIPAYMFI
MNITRMKEFSNQMIEVMPWINGISTSDEYDQLIELMDELVEDYEGNQVLIDLLFPVIERYESESEEFNEFNRVVGELEPG
LAMLRVIIDQNEMTLSDFKDEIGAKSTVSMILSGSRSLTLRHIKSLSERFNIPAYMFI
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|