Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 42416..43049 | Replicon | plasmid P |
Accession | NZ_LT960613 | ||
Organism | Vibrio tapetis subsp. tapetis isolate Vibrio tapetis CECT4600 |
Toxin (Protein)
Gene name | higB | Uniprot ID | B2LS89 |
Locus tag | VTAP4600_RS25545 | Protein ID | WP_012397026.1 |
Coordinates | 42416..42748 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | VTAP4600_RS25550 | Protein ID | WP_012397027.1 |
Coordinates | 42735..43049 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VTAP4600_RS25525 | 37854..38189 | - | 336 | WP_012397022.1 | hypothetical protein | - |
VTAP4600_RS25530 | 38274..38660 | - | 387 | WP_012397023.1 | hypothetical protein | - |
VTAP4600_RS25535 | 38684..39028 | - | 345 | WP_012397024.1 | hypothetical protein | - |
VTAP4600_RS25540 | 39712..41535 | - | 1824 | WP_102525550.1 | ParB/RepB/Spo0J family partition protein | - |
VTAP4600_RS25545 | 42416..42748 | + | 333 | WP_012397026.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
VTAP4600_RS25550 | 42735..43049 | + | 315 | WP_012397027.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
VTAP4600_RS25555 | 43465..43956 | + | 492 | WP_012397028.1 | RDD family protein | - |
VTAP4600_RS25560 | 44552..46084 | + | 1533 | WP_102521770.1 | IS21 family transposase | - |
VTAP4600_RS25565 | 46094..46834 | + | 741 | WP_012397030.1 | IS21-like element helper ATPase IstB | - |
VTAP4600_RS25570 | 46979..47446 | + | 468 | WP_012397031.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..82266 | 82266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12983.80 Da Isoelectric Point: 9.9244
>T293854 WP_012397026.1 NZ_LT960613:42416-42748 [Vibrio tapetis subsp. tapetis]
MRSIFVESTIFEKYRYEYLSDDEFRLFQAELMSNPNQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS
MRSIFVESTIFEKYRYEYLSDDEFRLFQAELMSNPNQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|