Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 3646263..3646896 | Replicon | chromosome |
Accession | NZ_LT960611 | ||
Organism | Vibrio tapetis subsp. tapetis isolate Vibrio tapetis CECT4600 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | VTAP4600_RS16400 | Protein ID | WP_102523754.1 |
Coordinates | 3646263..3646595 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | VTAP4600_RS16405 | Protein ID | WP_012397027.1 |
Coordinates | 3646582..3646896 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VTAP4600_RS16395 | 3644519..3645382 | - | 864 | WP_102523753.1 | ParB/RepB/Spo0J family partition protein | - |
VTAP4600_RS16400 | 3646263..3646595 | + | 333 | WP_102523754.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
VTAP4600_RS16405 | 3646582..3646896 | + | 315 | WP_012397027.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
VTAP4600_RS16410 | 3647312..3647803 | + | 492 | WP_012397028.1 | RDD family protein | - |
VTAP4600_RS16415 | 3648399..3649931 | + | 1533 | WP_102521770.1 | IS21 family transposase | - |
VTAP4600_RS16420 | 3649941..3650681 | + | 741 | WP_012397030.1 | IS21-like element helper ATPase IstB | - |
VTAP4600_RS16425 | 3650826..3651293 | + | 468 | WP_012397031.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12997.87 Da Isoelectric Point: 10.0511
>T293847 WP_102523754.1 NZ_LT960611:3646263-3646595 [Vibrio tapetis subsp. tapetis]
MRSIFVESTIFEKYRYEYLSDDEFRLFQAELMSNPKQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS
MRSIFVESTIFEKYRYEYLSDDEFRLFQAELMSNPKQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|