Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3488847..3489476 | Replicon | chromosome |
Accession | NZ_LT934425 | ||
Organism | Candidatus Kuenenia stuttgartiensis isolate kuenenia_mbr1_ru-nijmegen |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | KSMBR1_RS16315 | Protein ID | WP_099326265.1 |
Coordinates | 3488847..3489140 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | KSMBR1_RS16320 | Protein ID | WP_099326266.1 |
Coordinates | 3489159..3489476 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KSMBR1_RS16290 | 3484258..3485772 | + | 1515 | WP_099326261.1 | IMP dehydrogenase | - |
KSMBR1_RS16295 | 3486163..3487281 | + | 1119 | WP_099326262.1 | acyltransferase | - |
KSMBR1_RS16300 | 3487355..3487543 | + | 189 | WP_099326263.1 | hypothetical protein | - |
KSMBR1_RS16305 | 3487687..3487815 | + | 129 | WP_197705231.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
KSMBR1_RS22110 | 3488113..3488229 | + | 117 | WP_197705232.1 | hypothetical protein | - |
KSMBR1_RS22115 | 3488411..3488554 | + | 144 | WP_197705233.1 | hypothetical protein | - |
KSMBR1_RS16315 | 3488847..3489140 | + | 294 | WP_099326265.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KSMBR1_RS16320 | 3489159..3489476 | + | 318 | WP_099326266.1 | HigA family addiction module antidote protein | Antitoxin |
KSMBR1_RS16325 | 3489643..3490023 | + | 381 | WP_099326267.1 | hypothetical protein | - |
KSMBR1_RS16330 | 3490227..3490784 | + | 558 | WP_157820667.1 | GNAT family N-acetyltransferase | - |
KSMBR1_RS16335 | 3490968..3492491 | + | 1524 | WP_099326269.1 | IS1380-like element ISCku9 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3490968..3492491 | 1523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11222.65 Da Isoelectric Point: 7.2446
>T293842 WP_099326265.1 NZ_LT934425:3488847-3489140 [Candidatus Kuenenia stuttgartiensis]
VIQSFHDKGTEDIFDRKNTREARKTCPQQIWRAAQRKLDQLNGVVSLGSLKIPPGNMLEVLKDDRKGQHSIRINDQFRVC
FVWADDGVDNVEITDYH
VIQSFHDKGTEDIFDRKNTREARKTCPQQIWRAAQRKLDQLNGVVSLGSLKIPPGNMLEVLKDDRKGQHSIRINDQFRVC
FVWADDGVDNVEITDYH
Download Length: 294 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 12152.29 Da Isoelectric Point: 10.0019
>AT293842 WP_099326266.1 NZ_LT934425:3489159-3489476 [Candidatus Kuenenia stuttgartiensis]
MVRIPKNGPPTHPGEMLLEEFLKPLHMTQRELAEKLGVSYPRVNELIHGKRGMTPDTALRLEKLFGMDAQFWLNLQLAWD
LYHVTHSSTAKEIQKIKRLPAFIHV
MVRIPKNGPPTHPGEMLLEEFLKPLHMTQRELAEKLGVSYPRVNELIHGKRGMTPDTALRLEKLFGMDAQFWLNLQLAWD
LYHVTHSSTAKEIQKIKRLPAFIHV
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|